Re: [R] Accessing all the first sub-elements of a list of list

Try this: lapply(l, '[', 'desc') On Thu, Apr 23, 2009 at 8:13 AM, Amelia Baud wrote: > Hello, > > > > The 179th and 180th elements of my list of lists look like this: > > > > [[179]] > > [[179]]$desc > > [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN > KINASE HCK." > >

[R] Accessing all the first sub-elements of a list of list

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYD