ED]
Homepage Title
http://yabb.xnull.com
Signature
3
Administrator
571803
HyrumAIM
HyrumYIM
Male
I Love YaBB 1 Gold!!!
bobafett.gif
01/01/01 at 01:01:01
Kitchener
07/14/1975
4
2
How can I grab all of these for each dat file I open up?
Jeff
--
PHP General Mailing List (http://www.php.net/)
To un
Yes actually, I figured it out. I was trying to parse the buffer as well
but managed to figure it out tonight :) Just took a lot of debugging ;)
Jeff
> -Original Message-
> From: David Robley [mailto:[EMAIL PROTECTED]]
> Sent: Thursday, July 26, 2001 9:31 PM
> To: Jeff L
Why don't you just dump the data and structure and then use that to import
it? I'm sure there is something to do in telnet but I am unfamiliar :)
Jeff
- Original Message -
From: "PHP Junkie" <[EMAIL PROTECTED]>
To: <[EMAIL PROTECTED]>
Sent: Friday, July
?
Jeff
Using this function to dump a table, having a problem outputting the value
below after the SELECT * FROM $ID.
function dump($ID, $link) {
echo "Dumped table $ID";
$fields = mysql_list_fields("hyrum_nuke", $ID, $link);
$columns = mysql_num_fields($f
between each other.
Here is what I have for the first script/page after the form. I don't know what
to do after this on the second page in order to pass the variables on to it.
Thanks for any help.
Jeff Oien
-
$title
If you can see this message you are
No need to get nasty :) Keep the list friendly, it's better that way ;)
Jeff
- Original Message -
From: "B. van Ouwerkerk" <[EMAIL PROTECTED]>
To: <[EMAIL PROTECTED]>
Sent: Monday, July 30, 2001 8:53 AM
Subject: Re: [PHP] Need for dox...
&
One thing I would like to see is using PGP (or gnu) encryption on the server,
not via e-mail.
Jeff Oien
> Hi there,
>
> I'm currently in the process of writing a new book about PHP entitled PHP Exertion.
>
> I've read several other books, and none of them covered everyth
. It's a bse 100
system. a rating over 100 is very good.
Jeff
--
PHP General Mailing List (http://www.php.net/)
To unsubscribe, e-mail: [EMAIL PROTECTED]
For additional commands, e-mail: [EMAIL PROTECTED]
To contact the list administrators, e-mail: [EMAIL PROTECTED]
Remove the quotes around $uid
Jeff
- Original Message -
From: "Jeremy Morano" <[EMAIL PROTECTED]>
To: <[EMAIL PROTECTED]>
Sent: Tuesday, July 31, 2001 11:09 AM
Subject: [PHP] whats wrong?
> Anythig visibly wrong with this?
>
>
>
> "&
aybe ones that
can be found in the manual but they are starting out and need a bit of a
kick start.
Lets remain friendly...it's why I'm still around :)
Jeff
www.hyrum.net
www.xnull.com
> -Original Message-
> From: Steve Wright [mailto:[EMAIL PROTECTED]]
> Sent: Tuesda
I'd be happy to host one but I imagine there is one already for the list?
Jeff
> -Original Message-
> From: mike cullerton [mailto:[EMAIL PROTECTED]]
> Sent: Tuesday, July 31, 2001 3:08 PM
> To: php
> Subject: Re: [PHP] Attitude of B van Ouwerkerk
>
>
> on
it is
selected as dynamic text.
Hope this helps.
Jeff Pearson
> -Original Message-
> From: Kyle Smith [mailto:[EMAIL PROTECTED]]
> Sent: Tuesday, July 31, 2001 9:20 PM
> To: [EMAIL PROTECTED]
> Subject: [PHP] Flash question, but includes variables!
>
>
> Anybody
I've looked all over and can't find a content-type declaration for text.
This is my guess
header("Content-Type: text/txt");
but I'm not sure if this is right. I know this is more HTTP than PHP.
I want info to be displayed in a browser as plain text not HTML.
Thanks.
J
grammers with 2
years experience in any city and any keywords...
Jeff
Is there a routine out there to strip all characters from a phone
number except the numbers? I was going to write my own but
figured there must already be one out there I can use. Thanks.
Jeff Oien
--
PHP General Mailing List (http://www.php.net/)
To unsubscribe, e-mail: [EMAIL PROTECTED]
For
I'll bring it up to them.
Jeff Pearson
> -Original Message-
> From: Richard Baskett [mailto:[EMAIL PROTECTED]]
> Sent: Wednesday, August 01, 2001 6:00 PM
> To: [EMAIL PROTECTED]
> Subject: Re: [PHP] What would you want in a PHP web host?
>
>
> Please tell me wha
Ok, I have to admit, that made me laugh out loud here in the office :)
Jeff
- Original Message -
From: "scott [gts]" <[EMAIL PROTECTED]>
To: "php" <[EMAIL PROTECTED]>
Sent: Thursday, August 02, 2001 1:05 PM
Subject: RE: [PHP] Oh and one more thing
>
Try this SQL Justin:
$sql = "SELECT * FROM news DESC LIMIT 5";
Jeff
> -Original Message-
> From: Justin French [mailto:[EMAIL PROTECTED]]
> Sent: Saturday, August 04, 2001 5:52 AM
> To: php
> Subject: [PHP] most recent 5 rows
>
>
> Hi all,
>
Gerard,
Try using:
unset($Age);
Jeff
> -Original Message-
> From: Gerard Samuel [mailto:[EMAIL PROTECTED]]
> Sent: Saturday, August 04, 2001 1:34 AM
> To: PHP
> Subject: [PHP] How to destroy a $variable
>
>
> Ok I have a form with a $PHP_SELF target, and I
It will give you the 5 HIGHEST values in your auto incremented field. If it
was returneding the first 5, or the wrong 5, repace the DESC with ASC.
Jeff
> -Original Message-
> From: Justin French [mailto:[EMAIL PROTECTED]]
> Sent: Saturday, August 04, 2001 6:09 AM
> To: [EMA
Sorry, forgot the ORDER BY, here is what you're looking for:
$sql = "SELECT * FROM news ORDER BY id DESC LIMIT 5";
In a list of numbers up to 10, this would return rows 6,7,8,9, and 10.
Jeff
www.hyrum.net
www.xnull.com
> -Original Message-
> From: Jeff Lewis [ma
name doesn't. Not sure what I'm doing wrong. Thanks.
Jeff Oien
while ($row = mysql_fetch_array($result)) {
$First_Name = $row['First_Name'];
$Last_Name = $row['Last_Name'];
$Address = $row['Address'];
if ((
Thank you. That worked and I'm sure will have made it work a lot
faster later on when there is a lot of data in the database.
Jeff Oien
> On Sat, 4 Aug 2001 12:40:42 -0500, Jeff Oien ([EMAIL PROTECTED])
> wrote:
> >After a sign up page I want to check if someone is already
employer, a HUGE media/newspaper in Ontario goes with strictly Java.
Is it that people still are hesitant to go wth open source based technology?
Jeff Lewis
CT * FROM table";
$result = $db->query($sql);
while($row = $result->fetchRow(2)){
sleep(5);
}
}
?>
--
Jeff Bearer, RHCE
Webmaster
PittsburghLIVE.com
--
PHP General Mailing List (http://www.php.net/)
To unsubscribe, e-mail: [EMAIL PROTECTED]
For additional commands,
rm other sites.
I know it's going throught the IF statement because a $SessionID is
generated and printed out.
Is there a bug in the script, or is this an IE problem?
Thanks,
Jeff Gannaway
___
Find the right art print for your home.
* Search
tSession",$SessionID,time()+3600);
I also tried setting the expiration time earlier in a script and assigning
it to a variable:
$ExpTime = time()+3600
setcookie ("ArtPrintSession",$SessionID,$ExpTime);
That also didn't work.
The $ExpTime values look like:
997317780
What's t
ly ASP and Java.
Jeff
- Original Message -
From: "Rasmus Lerdorf" <[EMAIL PROTECTED]>
To: "Sean C. McCarthy" <[EMAIL PROTECTED]>
Cc: <[EMAIL PROTECTED]>
Sent: Thursday, August 09, 2001 12:20 PM
Subject: Re: [PHP] PHP in corporate settings?
Is there a prewritten function for capitalizing the first letter of each
word in a string except for the common words you wouldn't want
to capitalize in a title? Like
Come Learn the Facts From an Industry Leader
Thanks.
Jeff Oien
--
PHP General Mailing List (http://www.php.net
Fabulous. Thanks to Steve and Mark. Exactly what I needed.
Jeff Oien
> >Something like this, perhaps (untested):
>
> I needed this too so I just tested it.
>
> >function smart_ucwords($String)
> >{
> >
> > $ExceptionList = array('the&#x
Apache and PHP4
on Windows 2000 Professional. Thanks.
Jeff Oien
--
PHP General Mailing List (http://www.php.net/)
To unsubscribe, e-mail: [EMAIL PROTECTED]
For additional commands, e-mail: [EMAIL PROTECTED]
To contact the list administrators, e-mail: [EMAIL PROTECTED]
support in this PHP build
Anyone have any hints on how to fix this?
Jeff
Support: enabled
FreeType Linkage: with TTF library
JPG Support: enabled
WBMP Support: enabled
Jeff
- Original Message -
From: "scott [gts]" <[EMAIL PROTECTED]>
To: "php" <[EMAIL PROTECTED]>
Sent: Monday, August 20, 2001 10:57 AM
Subject: RE: [PHP] PNG s
http://www.php.net/manual/en/function.header.php
> Hi,
>
> I am sure there is an easy way to do this...
>
> But when my script is done doing whatever I want it to do - RATHER than
> print text and all to a page, I want the browser (within the same window) to
> go to a specific URL
>
> Can this
Best places I learned from are www.flashkit.com as well as the books Dynamic
Flash which includes a chapter on php. Other than that, I pulled apart
projects downloaded from flashkit.
Jeff Pearson
> -Original Message-
> From: Jack [mailto:[EMAIL PROTECTED]]
> Sent: Tuesday,
Try the following:
phpBB: http://www.phpbb.com/
Phorum: http://phorum.org/
Jeff Lewis
- Original Message -
From: "Emiliano Marmonti" <[EMAIL PROTECTED]>
To: "Lista PHP" <[EMAIL PROTECTED]>
Sent: Wednesday, August 22, 2001 4:26 AM
Subject: [PHP] Urgent
John,
Try this:
".$row->image_links."".$row->web_url."
".$row->image_link."".$row->web_url."\n");
}
?>
- Original Message -
From: "John Bass" <[EMAIL PROTECTED]>
To: <[EMAIL PROTECTED]>
Sent: Thursday, August 23, 2001 10:30 AM
Subject: [PHP] Need help to create HTML table with 2 co
What did you want in the second column? I was just going by what you had
listed below: $row->image_link,
> > > $row->web_url,$row->image_link, $row->web_url);
Jeff
- Original Message -
From: "John Bass" <[EMAIL PROTECTED]>
To: <[EMAIL PROTECTED
l for them?
Jeff Pearson
> -Original Message-
> From: Thomas Deliduka [mailto:[EMAIL PROTECTED]]
> Sent: Wednesday, August 22, 2001 7:31 PM
> To: PHP List
> Subject: [PHP] The future of PHP
>
>
> A little background... Skip to "THE JIST" if you wanna make t
t taken it down yet.
Notice it even gives info on PHP use :-)
Hope this helps.
Jeff Pearson
> -Original Message-
> From: Thomas Deliduka [mailto:[EMAIL PROTECTED]]
> Sent: Wednesday, August 22, 2001 7:31 PM
> To: PHP List
> Subject: [PHP] The future of PHP
>
Thomas,
Keeping in mind that preaching Languages is the same as religion. If someone
is decided for something, nothing you can say will change their mind; my
point in bringing up the numbers was that again, these numbers include ONLY
IT'S OWN CUSTOMERS If everyone was included in the poll, Im
m down the side of them so I can check the ones I want
approved.
Is it possible to have them all update with the click of one submit button?
Jeff
I actually had a talk with my boss today...
We discussed different technologies and why we chose them. The reasons we
chose Java/JSP/J2EE etc:
1) Scalability (number 1 reason)
2) Different projects like EJB etc
I had been talking about PHP a lot and he says he likes it to but...
Jeff
Has anyone come up with an abstraction layer that would allow the users of
their software to select either flat file or mySQL?
If so, is it downloadable somewhere or does anyone know or have any kind of
tips? :)
Jeff
--
PHP General Mailing List (http://www.php.net/)
To unsubscribe, e-mail
.
Jeff
> -Original Message-
> From: Michael Kimsal [mailto:[EMAIL PROTECTED]]
> Sent: Friday, August 24, 2001 5:34 PM
> To: [EMAIL PROTECTED]
> Cc: [EMAIL PROTECTED]
> Subject: Re: [PHP] The future of PHP
>
>
>
>
> Jeff Lewis wrote:
>
> >I actually
I would't say that. he says it's modular and easier to code in OOP.
Jeff
> -Original Message-
> From: Dave [mailto:[EMAIL PROTECTED]]
> Sent: Friday, August 24, 2001 6:15 PM
> To: [EMAIL PROTECTED]; Michael Kimsal
> Cc: [EMAIL PROTECTED]
> Subject:
You can read the notes lower on the page here to get a good idea:
http://www.php.net/manual/en/function.print.php
Jeff Oien
> I am fairly new to PHP Scripting, and I am learning from a book.
> Throughout the book, print is used as the basic command to output
> text/variables.. yet I s
You're on the wrong list for this question but...
-T runs the Perl script in Taint mode. It checks for possible security
holes. It marks any variable a user can control as unsecure.
-The shebang (#! /usr/bin/perl) is telling the script where it can find the
perl interpreter.
I want to check if an uploaded file is an image. This isn't working.
Could anyone help me out?
if (!eregi("\\.gif$", $img1_name) ||
!eregi("\\.jpg$", $img1_name) ||
!eregi("\\.jpeg$", $img1_name)) {
error message
}
Jeff Oien
--
PHP General Ma
When using this command:
mkdir ("/usr/www/users//blah/blah/$username", 0777);
it sets it to nobody instead of my username. I'm then unable
to delete or modify files in that directory. Is there a way around
this? Thanks.
Jeff Oien
--
PHP General Mailing List (http://w
However even the permission of 0777 doesn't let me do anything to
the directory or files in it. I can't even chown or chmod anything in
it using Telnet once it's created.
Jeff Oien
> Jeff
> JO> mkdir ("/usr/www/users//blah/blah/$username", 0777);
> J
27; '--with-pgsql' '--with-imap'
Thanks for any help, Jeff
__
Do You Yahoo!?
Make international calls for as low as $.04/minute with Yahoo! Messenger
http://phonecard.yahoo.com/
--
PHP General Mailing List (http://www.php.ne
I want the above to grab ONLY ones that have approved = 1. In the
database they are all = 0. Is there a problem with my SQL query?
Jeff
file_size / 1024 * 100) / 100 . "k";
} else {
$file_size = $file_size . "b";
}
is a code snippet from the PHP manual which allows you to display the file
size rounded and then GB. MB, or KB :)
Use the absolute file path for the file you want looked at.
Jeff
- Original Mess
nt to view (lets say www.php.net). It then
relays it to my browser but as if it is coming from my server. So can it grab the
pages, temp write them and server them over to me?
I know it seems kind of strange but I am curious about it....
Jeff
In your query add ORDER BY "field name like date or ID" DESC.
That way it will put them in descending order and I do believe that is what
you're looking for :)
Jeff
- Original Message -
From: "Tarrant Costelloe" <[EMAIL PROTECTED]>
To: <[EMAIL PROT
Damn, I wish I had read that thre was this event in Toronto, I would have
liked to attend! :)
> - Linux User Group in Toronto, Canada
I agree, suggestion and constructive criticism are fine but lets not start
attacking the guys who have put in countless hours to make PHP what it is
today. I'm
u.province, c.descrip,
e.descrip FROM resumes r,resumeHolders u, categories c, experience e WHERE
r.userID=u.userID AND r.categoryid=c.categoryid AND
r.experienceid=e.experienceid AND u.city='Kitchener'
Its getting to be a big select, not sure if it will work :)
Jeff
--
PHP Genera
Linux box? If not, is there a nice way
to convert the MDB to mySQL? :)
Jeff
page.
Jeff
k WidgetWorld.com at MainDomain.com.
However, if someone goes to WidgetWorld.com, it would pull up the index
page for MainDomain.com.
How can I use PHP to detect if the visitor wanted MainDomain.com (and
display MainDomain/index.php) or WidgetWorld.com (and then display
MainDomain/Widgets/index.php).
T
I have a user who is unable to upload files but I don't know where
to start with the troubleshooting process. I have this:
@copy("$img1", "/blah/$username/$img1_name")
or die("File upload didn't work.");
and they are getting the die message. All
I found the problem. A user was logged in under their username
with a different case (capital/small letters) and that caused a problem.
Jeff Oien
> I have a user who is unable to upload files but I don't know where
> to start with the troubleshooting process. I have this:
>
I needed this recently as well and found some converters right here:
http://www.mysql.com/documentation/mysql/bychapter/manual_Contrib.html#SEC60
7
They usually are run from within the MDB macros but it helped me convert my
database over :)
Jeff
- Original Message -
From: "Ro
ound will be white. If this is possible what's the best
way to go about it? Thanks.
Jeff Oien
--
PHP General Mailing List (http://www.php.net/)
To unsubscribe, e-mail: [EMAIL PROTECTED]
For additional commands, e-mail: [EMAIL PROTECTED]
To contact the list administrators, e-mail: [EMAIL PROTECTED]
echo " | Next >>"; //no link
}
elseif ($photo_pos < $count) {
$next_pos = $photo_pos;
$next = $array[$next_pos];
echo " | Next >>";
}
Comments from more experienced programmers welcome. I don&
actually information we use in this file :)
Jeff
***BATCHJobBATCH_384,SubmittedbyPRDMANOPERonNodeKWRB***%SET-W-NOTSET,errormodifyingKWRB$DKA0:-CLI-E-IVDEVTYPE,invaliddevicetype-specifyamailboxdevice$log*o=="logoff
o change it and heard
nothing back :)
Jeff
> -Original Message-
> From: Jean-Arthur Silve [mailto:[EMAIL PROTECTED]]
> Sent: Friday, September 07, 2001 6:07 AM
> To: [EMAIL PROTECTED]
> Subject: [PHP] PHP 4.0.6 + GD
>
>
> Hi !
>
> I used PHP 4.0.3pl1
Just use:
if (!$result){
code here
}
Jeff
> -Original Message-
> From: Andrew [mailto:[EMAIL PROTECTED]]
> Sent: Monday, September 10, 2001 1:34 PM
> To: [EMAIL PROTECTED]
> Subject: [PHP] test for empty $result??
>
>
> I know that this has been discussed b
Yeah not really a PHP topic but a very serious one! I can't believe this!
Two planes with the WTC, one into each tower. One of the towers have now
collapsed as well. A helicopter crashed into the Pentagon with unconfirmed
reports of a third hijacked plane also crashing into the Pentagon. A pla
lding thedrop down boxes it wouldbe like:
Computers - Programming (value of this would be something like 1/8) I would then split
the two values to do searches?
Jeff
txt = form.vemail.value;
if (txt.indexOf("@")<3)
{
alert("This email address seems wrong. Please check the prefix and
\"@\" sign.");
form.vemail.focus();
return false;
}
}
}
Thanks,
Jeff
--
Jeff Grossman ([EMAIL PROTECTED])
--
PHP General Mailing L
Yes. It is possible.
Jeff Pearson
> -Original Message-
> From: Bob [mailto:[EMAIL PROTECTED]]
> Sent: Wednesday, September 12, 2001 2:57 PM
> To: [EMAIL PROTECTED]
> Subject: [PHP] Verify email client can read html email?
>
>
> When sending out email is it p
I have an XML file that I need to parse. I had the base of a perl script written but
wasn't completely functioning and was hoping someone could give me a hand with making
it parse and do what it's supposed to but in PHP. The perl file looked like this:
#!/usr/bin/perl
use CGI::Carp qw(fatal
I have a very large text file that is set up like so: It contains some smaller
columns but one HUGE one that contains the body of a resume. I am looking for help on
processing this file. What I need to do is convert the final column into three
columns. Each column can have no more than 4000
t would be the
best way to do this?
Jeff
- Original Message -
From: "* R&zE:" <[EMAIL PROTECTED]>
To: "Jeff Lewis" <[EMAIL PROTECTED]>; <[EMAIL PROTECTED]>
Sent: Thursday, September 20, 2001 12:16 PM
Subject: Re: [PHP] Parsing text file and dividi
Check out http://www.eaccounts.net/ref/jp52950052/?referer=emaillink
The owner is a friend of mine.
Jeff Pearson
NOTE: In support of full disclosure, yes the link IS tracking referrels. I
do NOT recieve financial benefit from you clicking through. As mentioned
above, the owner is a friend of
Could someone tell me how to sort this? Each $variable1 is a 3,4 or 5
letter string that I would like sorted alphabetically. I assumed "sort" would
do it but apparently it isn't the right type of array. Thanks.
$variable1 = split("\n", $variable);
Jeff Oien
--
PHP G
This didn't get answered before. I'm trying to sort an array but it
won't work.
$list = file('list_main.txt');
$list = sort($list);
If I print $list it gives me 1 and print $list[0] is nothing. The list_main.txt
looks something like this:
ABC
DEFG
HIJ
etc.
Jeff Oien
--
le to
provide.
Jeff
is
> > completely invisible to the user that this page has been called? Because
of
> > course I don't want to allow users to have access to everything in my
> > control panel.
> >
> > Hopefully someone knows what I'm getting at. Thanks for any help you may
be
> > able to provide.
> >
> > Jeff
--
PHP General Mailing List (http://www.php.net/)
To unsubscribe, e-mail: [EMAIL PROTECTED]
For additional commands, e-mail: [EMAIL PROTECTED]
To contact the list administrators, e-mail: [EMAIL PROTECTED]
make sure it is a valid code or that it hasn;t been used
already?
Or if there are other similar ways that would be cool to know as well.
Jeff
--
PHP General Mailing List (http://www.php.net/)
To unsubscribe, e-mail: [EMAIL PROTECTED]
For additional commands, e-mail: [EMAIL PROTECTED]
To contact
Is it possible to have a script at xyz.com retrieve data from a mySQL database on
abc.com?
Jeff
I am assuming that all I need to change is the host/domain so that instead
of localhost it would be something else. Am I assuming right? So I could
have www.abc.com or the IP?
Jeff
- Original Message -
From: <[EMAIL PROTECTED]>
To: "Jeff Lewis" <[EMAIL PROTECTED]>
My friend owns a hosting company that supports php and MySQL along with a
ton of other things.and they are VERY inexpensive. You can check them
out at http://www.eaccounts.net/ref/jp52950052/?referer=emaillink
Jeff Pearson
Disclaimer: Yes the link tracks the referrals.No. I don't mak
together and then
discard the two numbers and only send $rate_1m? If that makes any sense.
Thanks.
Jeff
--
PHP General Mailing List (http://www.php.net/)
To unsubscribe, visit: http://www.php.net/unsub.php
Does is_numeric include commas decimals and dollar signs?
How do I use this to error check form data? I'm having a hard time
figuring out what the correct syntax is for that application. Thanks.
Jeff
--
PHP General Mailing List (http://www.php.net/)
To unsubscribe, visit: http://www.ph
Jeff Oien wrote:
Does is_numeric include commas decimals and dollar signs?
How do I use this to error check form data? I'm having a hard time
figuring out what the correct syntax is for that application. Thanks.
Jeff
I think what I should have asked is how to tell if something is not
num
won't post
the data. Thanks
Jeff
-
function http_post($host, $path, $data)
{
$http_response = '';
$content_length = strlen($data);
$fp = fsockopen($host, 80);
fputs($fp, "POST $path HTTP/1.1\r\n");
fputs($fp, "Host: $host\r\n&q
Justin Patrin wrote:
On Wed, 04 Aug 2004 16:01:31 -0500, Jeff Oien <[EMAIL PROTECTED]> wrote:
I'm using the code below to post form data to an ASP script. But I need
to redirect to a "thank you" page when it all done or the person filling
out the form sees what they're no
doc_root" in php.ini
- Removing and re-installing PHP
- Troubleshooting content associations in O'Reilly WebSite Pro
Thanks
Jeff
--
PHP General Mailing List (http://www.php.net/)
To unsubscribe, visit: http://www.php.net/unsub.php
I'm using the code below and about a third of the posts aren't getting
through. We have no idea why and don't know where to start to trouble
shoot. Any ideas? Thanks.
Jeff
function http_post($host, $path, $data)
{
$http_response = '';
$content_length
and the same behavior exists. I am running IIS in Windows 2000. Any ideas?
Jeff
--
PHP General Mailing List (http://www.php.net/)
To unsubscribe, visit: http://www.php.net/unsub.php
ee each attempt to post and some that should
have been posted (we know because we get confirmation email) didn't show
up at all on their end. If it's on my end what would I look for? Thanks.
Jeff
--
PHP General Mailing List (http://www.php.net/)
To unsubscribe, visit: http://www.php.net/unsub.php
lus, I don't
know if this would solve the problem.
Jeff
--
PHP General Mailing List (http://www.php.net/)
To unsubscribe, visit: http://www.php.net/unsub.php
The error reporting level is the same as it was for the same websites on a
different server that is working.
Jeff
At 11:49 AM 8/26/2004, Greg Donald wrote:
On Thu, 2004-08-26 at 12:55, Jeff - Webmaster wrote:
> Hello all. I just finished placing a new server in production and PHP is
&g
Here is a snippet of the code that is being choked on. The first failure
comes from line 6:
The variables are being passed from an html form that calls this script
with the post method.
Jeff
At 12:06 PM 8/26/2004, John Holmes wrote:
From: "Jeff - HarborNet" <[EMAIL PROTECTED]&
iness
Venue: $venue
Comments: $comments";
$success = @mail($to,$subject,$body,$headers);
?>
At 12:06 PM 8/26/2004, John Holmes wrote:
From: "Jeff - HarborNet" <[EMAIL PROTECTED]>
Hello all. I just finished placing a new server in production and PHP
Intersting. This is the same pair of html and php files that was functional
on another server. Can you think of any reason that could account for the
difference?
Jeff
At 01:51 PM 8/26/2004, John Holmes wrote:
Jeff - Webmaster wrote:
Another website dies on line 4 here:
$headers .= "
801 - 900 of 1162 matches
Mail list logo
