Jane Sun <[EMAIL PROTECTED]> wrote:Hi, Sean; Thank you very much for your sooner reply. While that's what I mean: I checked this tutorial document and it only shows how to run RemoteBlast with a FASTA sequence FILE (*.fasta, for example a protein sequence file with annotation line, protein accession number and protein ID), I just wondering if I use only a sequence data, such as "SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN", how can I get it works? Thanks again. Jane
Sean Davis <[EMAIL PROTECTED]> wrote: Jane, You should probably look at the BioPerl tutorial (http://www.bioperl.org/Core/Latest/ bptutorial.html#iii.4.1_running_blast_(using_remoteblast.pm). There are many tools for doing such things. Sean On Jul 20, 2004, at 12:08 PM, Jane Sun wrote: > Where can I find the examples or source code for running BLAST with a > input SEQUENCE using RemoteBlast.pm? > > From the bioperl online documentation, I can only get the example on > running BLAST with a sequnce FILE using RemoteBlast.pm > > Thanks in advance. > Jane > > > > __________________________________________________ > Do You Yahoo!? > Tired of spam? Yahoo! Mail has the best spam protection around > http://mail.yahoo.com --------------------------------- Do you Yahoo!? Vote for the stars of Yahoo!'s next ad campaign! __________________________________________________ Do You Yahoo!? Tired of spam? Yahoo! Mail has the best spam protection around http://mail.yahoo.com
